SRRM4 Antibody

Images

 
Immunohistochemistry: SRRM4 Antibody [NBP2-31389] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRRM4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATEPLGTNSWERDKTCRELG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRRM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SRRM4 Protein (NBP2-31389PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRRM4 Antibody

  • KIAA1853
  • medulloblastoma antigen MU-MB-2.76
  • MU-MB-2.76
  • neural-specific SR-related protein of 100 kDa
  • nSR100
  • serine/arginine repetitive matrix 4
  • serine/arginine repetitive matrix protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83998
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-49638
Species: Hu
Applications: IHC
NBP1-80820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85966
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-60521
Species: Hu
Applications: WB, Flow
NBP2-31389
Species: Hu
Applications: IHC, IHC-P

Publications for SRRM4 Antibody (NBP2-31389) (0)

There are no publications for SRRM4 Antibody (NBP2-31389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRRM4 Antibody (NBP2-31389) (0)

There are no reviews for SRRM4 Antibody (NBP2-31389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SRRM4 Antibody (NBP2-31389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRRM4 Products

SRRM4 NBP2-31389

Bioinformatics Tool for SRRM4 Antibody (NBP2-31389)

Discover related pathways, diseases and genes to SRRM4 Antibody (NBP2-31389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRRM4 Antibody (NBP2-31389)

Discover more about diseases related to SRRM4 Antibody (NBP2-31389).
 

Pathways for SRRM4 Antibody (NBP2-31389)

View related products by pathway.

Blogs on SRRM4

There are no specific blogs for SRRM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRRM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRRM4
Uniprot