SRRD Antibody

Images

 
Western Blot: SRRD Antibody [NBP1-70715] - Jurkat, Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: SRRD Antibody [NBP1-70715] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SRRD Antibody [NBP1-70715] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: SRRD Antibody [NBP1-70715] - MCF7, Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in MCF7.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRRD Antibody Summary

Immunogen
Synthetic peptides corresponding to SRRD(SRR1 domain containing) The peptide sequence was selected from the middle region of SRRD. Peptide sequence DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRRD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SRRD and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SRRD Antibody

  • SRR1 domain containing

Background

SRRD belongs to the SRR1 family. It may be involved in a circadian clock input pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84209
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-70715
Species: Hu
Applications: WB

Publications for SRRD Antibody (NBP1-70715) (0)

There are no publications for SRRD Antibody (NBP1-70715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRRD Antibody (NBP1-70715) (0)

There are no reviews for SRRD Antibody (NBP1-70715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRRD Antibody (NBP1-70715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRRD Products

SRRD NBP1-70715

Bioinformatics Tool for SRRD Antibody (NBP1-70715)

Discover related pathways, diseases and genes to SRRD Antibody (NBP1-70715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRRD Antibody (NBP1-70715)

Discover more about diseases related to SRRD Antibody (NBP1-70715).
 

Pathways for SRRD Antibody (NBP1-70715)

View related products by pathway.

Blogs on SRRD

There are no specific blogs for SRRD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRRD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRRD