Recombinant Human SRP54 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SRP54 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human SRP54

Source: Wheat Germ

Amino Acid Sequence: MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SRP54
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SRP54 Protein

  • signal recognition particle 54 kDa protein
  • signal recognition particle 54kD
  • signal recognition particle 54kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89507
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NBP1-89498
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89532
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65759
Species: Hu
NBP2-65892
Species: Hu
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81577
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61615
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00006729-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SRP54 Partial Recombinant Protein (H00006729-Q01) (0)

There are no publications for SRP54 Partial Recombinant Protein (H00006729-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRP54 Partial Recombinant Protein (H00006729-Q01) (0)

There are no reviews for SRP54 Partial Recombinant Protein (H00006729-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRP54 Partial Recombinant Protein (H00006729-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRP54 Products

Bioinformatics Tool for SRP54 Partial Recombinant Protein (H00006729-Q01)

Discover related pathways, diseases and genes to SRP54 Partial Recombinant Protein (H00006729-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRP54 Partial Recombinant Protein (H00006729-Q01)

Discover more about diseases related to SRP54 Partial Recombinant Protein (H00006729-Q01).
 

Pathways for SRP54 Partial Recombinant Protein (H00006729-Q01)

View related products by pathway.

PTMs for SRP54 Partial Recombinant Protein (H00006729-Q01)

Learn more about PTMs related to SRP54 Partial Recombinant Protein (H00006729-Q01).
 

Research Areas for SRP54 Partial Recombinant Protein (H00006729-Q01)

Find related products by research area.

Blogs on SRP54

There are no specific blogs for SRP54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SRP54 Antibody
NBP2-13380
SRP72 Antibody
NBP1-89498

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SRP54 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SRP54