SPRR2F Antibody (5A9)

Images

 
Western Blot: SPRR2F Antibody (5A9) [H00006705-M03] - Analysis of SPRR2F expression in transfected 293T cell line by SPRR2F monoclonal antibody (M03), clone 5A9. Lane 1: SPRR2F transfected lysatE (7.8 KDa). Lane 2: ...read more
Sandwich ELISA: SPRR2F Antibody (5A9) [H00006705-M03] - Detection limit for recombinant GST tagged SPRR2F is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPRR2F Antibody (5A9) Summary

Immunogen
SPRR2F (NP_001014450.1, 1 a.a. - 72 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPRR2F
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPRR2F Antibody (5A9)

  • small proline-rich protein 2F
  • SPR-2F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-27072
Species: Hu, Am, Bv, Ca, Eq, Op, Pm
Applications: WB, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF470
Species: Mu
Applications: WB, IHC, Neut
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30889
Species: Hu
Applications: IHC, IHC-P

Publications for SPRR2F Antibody (H00006705-M03) (0)

There are no publications for SPRR2F Antibody (H00006705-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRR2F Antibody (H00006705-M03) (0)

There are no reviews for SPRR2F Antibody (H00006705-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPRR2F Antibody (H00006705-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPRR2F Products

SPRR2F H00006705-M03

Bioinformatics Tool for SPRR2F Antibody (H00006705-M03)

Discover related pathways, diseases and genes to SPRR2F Antibody (H00006705-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRR2F Antibody (H00006705-M03)

Discover more about diseases related to SPRR2F Antibody (H00006705-M03).
 

Pathways for SPRR2F Antibody (H00006705-M03)

View related products by pathway.

Blogs on SPRR2F

There are no specific blogs for SPRR2F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPRR2F Antibody (5A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRR2F
Uniprot