Recombinant Human Sodium-Calcium Exchanger Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Sodium-Calcium Exchanger Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-284 of Human SLC8A3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC8A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
57.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sodium-Calcium Exchanger Protein

  • Na(+)/Ca(2+)-exchange protein 3
  • Na+/Ca2+ exchanger 3
  • NCX3sodium/calcium exchanger SLC8A3
  • sodium/calcium exchanger 3
  • solute carrier family 8 (sodium/calcium exchanger), member 3
  • solute carrier family 8 (sodium-calcium exchanger), member 3

Background

This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56483
Species: Hu
Applications: ICC/IF
NBP2-48980
Species: Hu
Applications: IHC, IHC-P
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP2-31010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92397
Species: Hu
Applications: ICC/IF, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NB300-600
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
H00006547-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01) (0)

There are no publications for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01) (0)

There are no reviews for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sodium-Calcium Exchanger Products

Bioinformatics Tool for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01)

Discover related pathways, diseases and genes to Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01)

Discover more about diseases related to Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01).
 

Pathways for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01)

View related products by pathway.

PTMs for Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01)

Learn more about PTMs related to Sodium-Calcium Exchanger Recombinant Protein (H00006547-P01).

Blogs on Sodium-Calcium Exchanger

There are no specific blogs for Sodium-Calcium Exchanger, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sodium-Calcium Exchanger Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC8A3