SNX24 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SNX24 Antibody [NBP2-56620] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX24 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHA
Specificity
Specificity of human SNX24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX24
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SNX24 Antibody

  • PRO1284
  • SBBI31
  • sorting nexin 24
  • sorting nexin-24
  • sorting nexing 24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-75623
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-90926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79631
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
AF7528
Species: Hu
Applications: WB
NBP2-56620
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for SNX24 Antibody (NBP2-56620) (0)

There are no publications for SNX24 Antibody (NBP2-56620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX24 Antibody (NBP2-56620) (0)

There are no reviews for SNX24 Antibody (NBP2-56620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SNX24 Antibody (NBP2-56620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNX24 Products

Bioinformatics Tool for SNX24 Antibody (NBP2-56620)

Discover related pathways, diseases and genes to SNX24 Antibody (NBP2-56620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX24 Antibody (NBP2-56620)

Discover more about diseases related to SNX24 Antibody (NBP2-56620).
 

Pathways for SNX24 Antibody (NBP2-56620)

View related products by pathway.

Research Areas for SNX24 Antibody (NBP2-56620)

Find related products by research area.

Blogs on SNX24

There are no specific blogs for SNX24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX24 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX24