SMVT/SLC5A6 Antibody

Immunocytochemistry/Immunofluorescence: SMVT/SLC5A6 Antibody [NBP1-87021] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.

Immunohistochemistry-Paraffin: SMVT/SLC5A6 Antibody [NBP1-87021] - Staining of human epididymis shows strong positivity in cilia of the glandular cells.

Product Discontinued

SMVT/SLC5A6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC5A6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SMVT/SLC5A6 Antibody

• Na(+)-dependent multivitamin transporter
• SLC5A6
• SMVT
• SMVTNa+-dependent multivitamin transporter
• sodium-dependent multivitamin transporter
• solute carrier family 5 (sodium-dependent vitamin transporter), member 6
• Solute carrier family 5 member 6

Background

Transports pantothenate, biotin and lipoate in the presence of sodium

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC5A6