![Western Blot: SMG5 Antibody [NBP1-56778] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/SMG5-Antibody-Western-Blot-NBP1-56778-img0002.jpg "Western Blot: SMG5 Antibody [NBP1-56778] - Jurkat cell lysate, concentration 0.2-1 ug/ml.")
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SMG5(Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)) The peptide sequence was selected from the N terminal of SMG5. Peptide sequence MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMG5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SMG5 Antibody (NBP1-56778)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_15456.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_7016.jpg)
