SLC44A2 Antibody - Azide and BSA Free

Western Blot: SLC44A2 Antibody [NBP2-94586] - Analysis of extracts of various cell lines, using SLC44A2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 5s.

Product Discontinued

SLC44A2 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC44A2 (NP_065161.3). AEVLQDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTVSWYWIIIGLVIAMAMSLLFI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC44A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC44A2 Antibody - Azide and BSA Free

• CTL2choline transporter-like protein 2
• DKFZp666A071
• FLJ44586
• PP1292
• Solute carrier family 44 member 2
• solute carrier family 44, member 2

Background

SLC44A2, also known as Choline transporter-like protein 2, is a 80kDa 706 amino acid protein with a short 704 isoform approximately 80kDa and a longer 711 isoform approximately 81kDa. Isoform 1 may function as a choline transporter. Research is currently being conducted on SLC44A2 in relation tocarcinoma, leukemia, colon carcinoma and chronic lymphocytic leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC44A2