SETD6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SETD6 Antibody [NBP2-58089] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SETD6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SETD6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SETD6 Recombinant Protein Antigen (NBP2-58089PEP)

Reactivity Notes

Mouse 86%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SETD6 Antibody

  • SET domain containing 6
  • SET domain-containing protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-B0422-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NB100-2436
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-20116
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-58089
Species: Hu
Applications: ICC/IF

Publications for SETD6 Antibody (NBP2-58089) (0)

There are no publications for SETD6 Antibody (NBP2-58089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETD6 Antibody (NBP2-58089) (0)

There are no reviews for SETD6 Antibody (NBP2-58089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SETD6 Antibody (NBP2-58089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SETD6 Products

Bioinformatics Tool for SETD6 Antibody (NBP2-58089)

Discover related pathways, diseases and genes to SETD6 Antibody (NBP2-58089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETD6 Antibody (NBP2-58089)

Discover more about diseases related to SETD6 Antibody (NBP2-58089).
 

Pathways for SETD6 Antibody (NBP2-58089)

View related products by pathway.

PTMs for SETD6 Antibody (NBP2-58089)

Learn more about PTMs related to SETD6 Antibody (NBP2-58089).

Blogs on SETD6

There are no specific blogs for SETD6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SETD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD6