![Immunocytochemistry/Immunofluorescence: SETD6 Antibody [NBP2-58089] - Staining of human cell line PC-3 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/SETD6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58089-img0001.jpg "Immunocytochemistry/Immunofluorescence: SETD6 Antibody [NBP2-58089] - Staining of human cell line PC-3 shows localization to nucleoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SETD6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Histone H3 [Trimethyl Lys9] Antibody (6F12-H4)](https://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0012.jpg)
![Western Blot Histone H3 [Trimethyl Lys9] Antibody (6F12-H4)](https://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0013.jpg)
![Western Blot Histone H3 [Trimethyl Lys9] Antibody (6F12-H4)](https://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for SETD6 Antibody (NBP2-58089)Discover more about diseases related to SETD6 Antibody (NBP2-58089).
| Pathways for SETD6 Antibody (NBP2-58089)View related products by pathway.
|
PTMs for SETD6 Antibody (NBP2-58089)Learn more about PTMs related to SETD6 Antibody (NBP2-58089).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SETD6 |
-ELISA-NBP2-29661-img0006.jpg)
-ELISA-NBP2-29661-img0004.jpg)
-ELISA-NBP2-29661-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")