Septin-5 Recombinant Protein Antigen

Images

 
There are currently no images for Septin-5 Recombinant Protein Antigen (NBP2-49407PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Septin-5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Septin-5.

Source: E. coli

Amino Acid Sequence: VPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEPTIN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49407.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Septin-5 Recombinant Protein Antigen

  • CDCREL
  • CDCREL1
  • CDCREL-1
  • cell division control related protein 1
  • Cell division control-related protein 1
  • HCDCREL-1
  • peanut-like 1 (Drosophila)
  • peanut-like 1
  • Peanut-like protein 1
  • platelet glycoprotein Ib beta chain
  • PNUTL1H5
  • septin 5
  • septin-5

Background

This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is mapped to 22q11, the region frequently deleted in DiGeorge and velocardiofacial syndromes. A translocation involving the MLL gene and this gene has also been reported in patients with acute myeloid leukemia. Two transcripts of this gene, a major one of 2.2 kb and a minor one of 3.5 kb, have been observed. The 2.2 kb form results from the utilization of a non-consensus polyA signal (AACAAT). In the absence of polyadenylation from this imperfect site, the consensus polyA signal of the downstream neighboring gene (GP1BB; platelet glycoprotein Ib) is used, resulting in the 3.5 kb transcript. An alternatively spliced transcript variant with a different 5' end has also been identified, but its full-length nature has not been completely determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20154
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00003166-B01P-50ug
Species: Hu
Applications: WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89165
Species: Hu
Applications: IHC,  IHC-P
NBP3-46115
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-16333
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00009248-B01P
Species: Hu, Mu, Rt
Applications: Flow, KO, WB
DHAPG0
Species: Hu
Applications: ELISA
NBP2-49407PEP
Species: Hu
Applications: AC

Publications for Septin-5 Recombinant Protein Antigen (NBP2-49407PEP) (0)

There are no publications for Septin-5 Recombinant Protein Antigen (NBP2-49407PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-5 Recombinant Protein Antigen (NBP2-49407PEP) (0)

There are no reviews for Septin-5 Recombinant Protein Antigen (NBP2-49407PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Septin-5 Recombinant Protein Antigen (NBP2-49407PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Septin-5 Products

Research Areas for Septin-5 Recombinant Protein Antigen (NBP2-49407PEP)

Find related products by research area.

Blogs on Septin-5

There are no specific blogs for Septin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Septin-5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPTIN5