Septin-4 Antibody [DyLight 350]

Product Discontinued

Septin-4 Antibody [DyLight 350] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin-4 (NP_536341.1).
  
  Sequence:
  MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEPTIN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Septin-4 Antibody [DyLight 350]

• Apoptosis-related protein in the TGF-beta signaling pathway
• ARTSPeanut-like protein 2
• Bradeion beta
• BRADEION
• Brain protein H5
• CE5B3
• Cell division control-related protein 2
• Cerebral protein 7
• H5
• hCDCREL-2SEP4
• hucep-7
• MART
• peanut-like 2 (Drosophila)
• peanut-like 2
• PNUTL2CE5B3 beta
• septin 4
• septin-4
• septin-M

Background

Apoptosis is related to many diseases and development. Mitochondrial proteins, such as cytochrome c, Apaf-1, and AIF play important role in apoptosis. A novel mitochondrial septin-like protein was identified recently and designated ARTS for apoptosis related protein in TGF-b signaling pathway. ARTS that is encoded by the human septin H5/PNUTL2/CDCrel2b gene is located to mitochondria and translocates to the nucleus when apoptosis occurs. ARTS is expressed in many tissues. It enhances cell death induced by TGF-b and, to a lesser extent, by other apoptotic agents, such as TNF-a and Fas ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEPTIN4