Septin-4 Antibody [DyLight 488] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin-4 (NP_536341.1).
Sequence: MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SEPTIN4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for Septin-4 Antibody [DyLight 488]
Background
Apoptosis is related to many diseases and development. Mitochondrial proteins, such as cytochrome c, Apaf-1, and AIF play important role in apoptosis. A novel mitochondrial septin-like protein was identified recently and designated ARTS for apoptosis related protein in TGF-b signaling pathway. ARTS that is encoded by the human septin H5/PNUTL2/CDCrel2b gene is located to mitochondria and translocates to the nucleus when apoptosis occurs. ARTS is expressed in many tissues. It enhances cell death induced by TGF-b and, to a lesser extent, by other apoptotic agents, such as TNF-a and Fas ligand.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, KO, WB
Species: Hu
Applications: ELISA
Publications for Septin-4 Antibody (NBP3-35109G) (0)
There are no publications for Septin-4 Antibody (NBP3-35109G).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Septin-4 Antibody (NBP3-35109G) (0)
There are no reviews for Septin-4 Antibody (NBP3-35109G).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Septin-4 Antibody (NBP3-35109G) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Septin-4 Products
Research Areas for Septin-4 Antibody (NBP3-35109G)
Find related products by research area.
|
Blogs on Septin-4