SEP15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEP15 Antibody [NBP2-58690] - Staining of human cell line HeLa shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEP15 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLER
Specificity
Specificity of human SEP15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEP15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEP15 Recombinant Protein Antigen (NBP2-58690PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SEP15 Antibody

  • 15 kDa selenoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-20620
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
MAB5457
Species: Hu, Mu, Rt
Applications: WB
NBP1-90979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49599
Species: Hu, Mu
Applications: WB, ELISA, IP
NBP1-87782
Species: Hu
Applications: WB, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NB100-53795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, KD
NBP1-86120
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65483
Species: Hu
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SEP15 Antibody (NBP2-58690) (0)

There are no publications for SEP15 Antibody (NBP2-58690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEP15 Antibody (NBP2-58690) (0)

There are no reviews for SEP15 Antibody (NBP2-58690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEP15 Antibody (NBP2-58690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SEP15 Antibody (NBP2-58690)

Discover related pathways, diseases and genes to SEP15 Antibody (NBP2-58690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEP15 Antibody (NBP2-58690)

Discover more about diseases related to SEP15 Antibody (NBP2-58690).
 

Pathways for SEP15 Antibody (NBP2-58690)

View related products by pathway.

PTMs for SEP15 Antibody (NBP2-58690)

Learn more about PTMs related to SEP15 Antibody (NBP2-58690).

Blogs on SEP15

There are no specific blogs for SEP15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEP15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEP15