Recombinant Human Secretory phospholipase A2 Type V GST (N-Term) Protein Summary
| Description |
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-138 of Human PLA2G5 Source: Wheat Germ (in vitro) Amino Acid Sequence: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
PLA2G5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
42.1 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Secretory phospholipase A2 Type V GST (N-Term) Protein
Background
This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholipids and free fatty acids including arachidonic acid. It preferentially hydrolyzes linoleoyl-containing phosphatidylcholine substrates. Secretion of this enzyme is thought to induce inflammatory responses in neighboring cells. Alternatively spliced transcript variants have been found, but their full-length nature has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Secretory phospholipase A2 Type V Recombinant Protein (H00005322-P01) (0)
There are no publications for Secretory phospholipase A2 Type V Recombinant Protein (H00005322-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Secretory phospholipase A2 Type V Recombinant Protein (H00005322-P01) (0)
There are no reviews for Secretory phospholipase A2 Type V Recombinant Protein (H00005322-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Secretory phospholipase A2 Type V Recombinant Protein (H00005322-P01) (0)
Additional Secretory phospholipase A2 Type V Products
Research Areas for Secretory phospholipase A2 Type V Recombinant Protein (H00005322-P01)
Find related products by research area.
|
Blogs on Secretory phospholipase A2 Type V