Sec8 Antibody (4F1)

Images

 
Western Blot: Sec8 Antibody (4F1) [H00060412-M06] - Analysis of EXOC4 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Sec8 Antibody (4F1) [H00060412-M06] - Analysis of EXOC4 expression in PC-12 (Cat # L012V1).
Western Blot: Sec8 Antibody (4F1) [H00060412-M06] - Analysis of EXOC4 expression in Hela S3 NE (Cat # L013V3).
Western Blot: Sec8 Antibody (4F1) [H00060412-M06] - Analysis of EXOC4 expression in NIH/3T3 (Cat # L018V1).
ELISA: Sec8 Antibody (4F1) [H00060412-M06] - Detection limit for recombinant GST tagged EXOC4 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, S-ELISA
Clone
4F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Sec8 Antibody (4F1) Summary

Immunogen
EXOC4 (NP_068579, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD
Specificity
EXOC4 (4F1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EXOC4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00060412-M06.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sec8 Antibody (4F1)

  • exocyst complex component 4
  • KIAA1699SEC8L1
  • MGC27170
  • REC8
  • SEC8Exocyst complex component Sec8
  • SEC8-like 1 (S. cerevisiae)
  • SEC8-like 1
  • Sec8p

Background

The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Pm, Rb, Sh, Ye
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP1-84767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85031
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-99472
Species: Hu
Applications: IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00023433-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33714
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00060412-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, S-ELISA

Publications for Sec8 Antibody (H00060412-M06)(1)

Reviews for Sec8 Antibody (H00060412-M06) (0)

There are no reviews for Sec8 Antibody (H00060412-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sec8 Antibody (H00060412-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Sec8 Products

Bioinformatics Tool for Sec8 Antibody (H00060412-M06)

Discover related pathways, diseases and genes to Sec8 Antibody (H00060412-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sec8 Antibody (H00060412-M06)

Discover more about diseases related to Sec8 Antibody (H00060412-M06).
 

Pathways for Sec8 Antibody (H00060412-M06)

View related products by pathway.

PTMs for Sec8 Antibody (H00060412-M06)

Learn more about PTMs related to Sec8 Antibody (H00060412-M06).

Blogs on Sec8

There are no specific blogs for Sec8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sec8 Antibody (4F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC4
Entrez
OMIM
Uniprot