Recombinant Human SEC63 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SEC63 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 631-728 of Human SEC63 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKPVPENHPQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SEC63
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SEC63 Protein

  • PRO2507
  • SEC63 homolog (S. cerevisiae)
  • SEC63LERdj2
  • SEC63-like (S. cerevisiae)
  • translocation protein SEC63 homolog

Background

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1543
Species: Hu
Applications: WB, IHC
NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85002
Species: Hu
Applications: WB, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr

Publications for SEC63 Partial Recombinant Protein (H00011231-Q01) (0)

There are no publications for SEC63 Partial Recombinant Protein (H00011231-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC63 Partial Recombinant Protein (H00011231-Q01) (0)

There are no reviews for SEC63 Partial Recombinant Protein (H00011231-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC63 Partial Recombinant Protein (H00011231-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC63 Products

Bioinformatics Tool for SEC63 Partial Recombinant Protein (H00011231-Q01)

Discover related pathways, diseases and genes to SEC63 Partial Recombinant Protein (H00011231-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC63 Partial Recombinant Protein (H00011231-Q01)

Discover more about diseases related to SEC63 Partial Recombinant Protein (H00011231-Q01).
 

Pathways for SEC63 Partial Recombinant Protein (H00011231-Q01)

View related products by pathway.

PTMs for SEC63 Partial Recombinant Protein (H00011231-Q01)

Learn more about PTMs related to SEC63 Partial Recombinant Protein (H00011231-Q01).

Blogs on SEC63

There are no specific blogs for SEC63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SEC63 Antibody
NBP2-30405

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SEC63 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC63