SDCCAG8 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SDCCAG8. Source: E. coli Amino Acid Sequence: AKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNEDARTAWPELQQSHAVNQLKDLLRQQADKESEV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SDCCAG8 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56357. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SDCCAG8 Recombinant Protein Antigen
Background
SDCCAG8 is a gene that codes for a protein with four isoforms, with weights of 713, 360, 634, and 669 amino acids and weights of approximately 83, 41, 73, and 78 kDa respectively. The protein coded by SDCCAG8 helps in the formation of epithelial lumen as well as the establishment of cell polarity and is expressed in the thymus, prostate, testis, ovary, small intestine and mucosa as well as in colon and renal cancer tumors. Current studies are being done on several diseases and disorders linked to this gene including colon cancer, Senior-Loken syndrome, Bardet-Biegl syndrome, retinitis, nystagmus, eye disease, polydactyly, multiple sclerosis, and prostatitis. SDCCAG8 has also been shown to have interactions with TSC1, TRAF6, ALMS1, CEP152, and CEP164 in pathways such as the centrosome maturation, cell cycle, and G2/M transition pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KO, WB
Species: Hu
Applications: Bind
Publications for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP) (0)
There are no publications for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP) (0)
There are no reviews for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP) (0)
Additional SDCCAG8 Products
Blogs on SDCCAG8