SDCCAG8 Recombinant Protein Antigen

Images

 
There are currently no images for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SDCCAG8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SDCCAG8.

Source: E. coli

Amino Acid Sequence: AKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNEDARTAWPELQQSHAVNQLKDLLRQQADKESEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SDCCAG8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56357.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SDCCAG8 Recombinant Protein Antigen

  • CCCAPAntigen NY-CO-8
  • Centrosomal colon cancer autoantigen protein
  • hCCCAP
  • NPHP10
  • NY-CO-8
  • serologically defined colon cancer antigen 8
  • SLSN7

Background

SDCCAG8 is a gene that codes for a protein with four isoforms, with weights of 713, 360, 634, and 669 amino acids and weights of approximately 83, 41, 73, and 78 kDa respectively. The protein coded by SDCCAG8 helps in the formation of epithelial lumen as well as the establishment of cell polarity and is expressed in the thymus, prostate, testis, ovary, small intestine and mucosa as well as in colon and renal cancer tumors. Current studies are being done on several diseases and disorders linked to this gene including colon cancer, Senior-Loken syndrome, Bardet-Biegl syndrome, retinitis, nystagmus, eye disease, polydactyly, multiple sclerosis, and prostatitis. SDCCAG8 has also been shown to have interactions with TSC1, TRAF6, ALMS1, CEP152, and CEP164 in pathways such as the centrosome maturation, cell cycle, and G2/M transition pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89354
Species: Hu
Applications: IHC,  IHC-P
AF7116
Species: Hu
Applications: WB
NBP3-05039
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-38255
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-81843
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-93637
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-16285
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-93653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-76351
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-88692
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC,  IHC-P, WB
NBP2-13249
Species: Hu
Applications: IHC,  IHC-P
NB100-86991
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-14274
Species: Hu
Applications: IHC,  IHC-P
NBP2-92653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KO, WB
5609-MU
Species: Hu
Applications: Bind

Publications for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP) (0)

There are no publications for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP) (0)

There are no reviews for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SDCCAG8 Recombinant Protein Antigen (NBP2-56357PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SDCCAG8 Products

Blogs on SDCCAG8

There are no specific blogs for SDCCAG8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SDCCAG8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SDCCAG8