SAPCD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SAPCD2 Antibody [NBP1-91740] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SAPCD2 Antibody [NBP1-91740] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Staining of human colon shows moderate cytoplasmic membranous positivity in endothelial cells.

Staining of human cerebral cortex shows moderate cytoplasmic membranous positivity in endothelial cells.

Staining of human kidney shows moderate cytoplasmic membranous positivity in cells in glomeruli.

Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

SAPCD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SAPCD2 Antibody - BSA Free (NBP1-91740) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SAPCD2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVARC
• Predicted Species: Mouse (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SAPCD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SAPCD2 Antibody - BSA Free

• C9orf140
• chromosome 9 open reading frame 140
• p42.3
• SAPCD2
• suppressor APC domain containing 2

Background

Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SAPCD2 Antibody (NBP1-91740)(2)

Publications using NBP1-91740

• Sun Z, Mao Y, Zhang X et al. Identification of ARHGEF38, NETO2, GOLM1, and SAPCD2 Associated With Prostate Cancer Progression by Bioinformatic Analysis and Experimental Validation Frontiers in Cell and Developmental Biology 2021-09-01 [PMID: 34540835] (Immunohistochemistry)
• Baker AL Investigating the Novel Oncogenic Function of SAPCD2 in Pediatric Neuroblastoma Thesis 2021-01-01 (WB)

Bioinformatics

• Gene Symbol: SAPCD2
• Entrez:
  • 89958(Human)
• Uniprot:
  • Q86UD0(Human)