Immunocytochemistry/ Immunofluorescence: SAPCD2 Antibody [NBP1-91740] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SAPCD2 Antibody [NBP1-91740] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.
Staining of human colon shows moderate cytoplasmic membranous positivity in endothelial cells.
Staining of human cerebral cortex shows moderate cytoplasmic membranous positivity in endothelial cells.
Staining of human kidney shows moderate cytoplasmic membranous positivity in cells in glomeruli.
Staining of human liver shows no positivity in hepatocytes as expected.
Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!
Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research
SAPCD2 Antibody - BSA Free Summary
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVARC
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAPCD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for SAPCD2 Antibody - BSA Free
C9orf140
chromosome 9 open reading frame 140
p42.3
SAPCD2
suppressor APC domain containing 2
Background
Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SAPCD2 Antibody - BSA Free and receive a gift card or discount.