Recombinant Human RSK4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RSK4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 636-745 of Human RPS6KA6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPS6KA6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RSK4 Protein

  • EC 2.7.11
  • EC 2.7.11.1
  • p90-RSK 6
  • p90RSK6
  • pp90RSK4
  • PP90RSK4,90 kDa ribosomal protein S6 kinase 6
  • ribosomal protein S6 kinase alpha-6
  • ribosomal protein S6 kinase, 90kDa, polypeptide 6
  • Ribosomal S6 kinase 4
  • RPS6KA6
  • RSK4
  • RSK-4
  • RSK4ribosomal protein S6 kinase, 90kD, polypeptide 6
  • S6K-alpha 6
  • S6K-alpha-6

Background

RPS6KA6 - ribosomal protein S6 kinase, 90kDa, polypeptide 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59722
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027330-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RSK4 Partial Recombinant Protein (H00027330-Q01) (0)

There are no publications for RSK4 Partial Recombinant Protein (H00027330-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSK4 Partial Recombinant Protein (H00027330-Q01) (0)

There are no reviews for RSK4 Partial Recombinant Protein (H00027330-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RSK4 Partial Recombinant Protein (H00027330-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RSK4 Products

Bioinformatics Tool for RSK4 Partial Recombinant Protein (H00027330-Q01)

Discover related pathways, diseases and genes to RSK4 Partial Recombinant Protein (H00027330-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSK4 Partial Recombinant Protein (H00027330-Q01)

Discover more about diseases related to RSK4 Partial Recombinant Protein (H00027330-Q01).
 

Pathways for RSK4 Partial Recombinant Protein (H00027330-Q01)

View related products by pathway.

PTMs for RSK4 Partial Recombinant Protein (H00027330-Q01)

Learn more about PTMs related to RSK4 Partial Recombinant Protein (H00027330-Q01).
 

Research Areas for RSK4 Partial Recombinant Protein (H00027330-Q01)

Find related products by research area.

Blogs on RSK4

There are no specific blogs for RSK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RSK4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA6
Entrez