Recombinant Human RPP14 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPP14 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27395 of Human RPP14 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPP14

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPP14 Protein

  • EC 3.1.26.5
  • EC 4.2.1.-
  • FLJ31508
  • HsHTD2
  • P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  • ribonuclease P (14kD)
  • ribonuclease P 14kDa subunit
  • ribonuclease P protein subunit p14
  • ribonuclease P/MRP 14kDa subunit

Background

RPP14 - ribonuclease P 14kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
H00011102-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RPP14 Partial Recombinant Protein (H00011102-Q01) (0)

There are no publications for RPP14 Partial Recombinant Protein (H00011102-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP14 Partial Recombinant Protein (H00011102-Q01) (0)

There are no reviews for RPP14 Partial Recombinant Protein (H00011102-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPP14 Partial Recombinant Protein (H00011102-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPP14 Products

Bioinformatics Tool for RPP14 Partial Recombinant Protein (H00011102-Q01)

Discover related pathways, diseases and genes to RPP14 Partial Recombinant Protein (H00011102-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP14 Partial Recombinant Protein (H00011102-Q01)

Discover more about diseases related to RPP14 Partial Recombinant Protein (H00011102-Q01).
 

Pathways for RPP14 Partial Recombinant Protein (H00011102-Q01)

View related products by pathway.

PTMs for RPP14 Partial Recombinant Protein (H00011102-Q01)

Learn more about PTMs related to RPP14 Partial Recombinant Protein (H00011102-Q01).

Blogs on RPP14

There are no specific blogs for RPP14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
RPP14 Antibody
NBP1-80965

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPP14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP14