Recombinant Human RPL4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPL4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 251-350 of Human RPL4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR

Protein/Peptide Type
Partial Recombinant Protein
Gene
RPL4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPL4 Protein

  • ribosomal protein L4,60S ribosomal protein L1,60S ribosomal protein L4
  • RPL1

Background

RPL4 - ribosomal protein L4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
CD6
627-CD
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00006124-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RPL4 Partial Recombinant Protein (H00006124-Q01) (0)

There are no publications for RPL4 Partial Recombinant Protein (H00006124-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL4 Partial Recombinant Protein (H00006124-Q01) (0)

There are no reviews for RPL4 Partial Recombinant Protein (H00006124-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL4 Partial Recombinant Protein (H00006124-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL4 Products

Bioinformatics Tool for RPL4 Partial Recombinant Protein (H00006124-Q01)

Discover related pathways, diseases and genes to RPL4 Partial Recombinant Protein (H00006124-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL4 Partial Recombinant Protein (H00006124-Q01)

Discover more about diseases related to RPL4 Partial Recombinant Protein (H00006124-Q01).
 

Pathways for RPL4 Partial Recombinant Protein (H00006124-Q01)

View related products by pathway.

Blogs on RPL4

There are no specific blogs for RPL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL4 Antibody (4A3)
H00006124-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL4