Recombinant Human RPL14 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RPL14 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-90 of Human RPL14

Source: Wheat Germ

Amino Acid Sequence: MVFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPL14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPL14 Protein

  • CAG-ISL 7
  • CAG-ISL-7
  • CTG-B33
  • hRL14
  • L14
  • MGC88594
  • MMRPL32,60S ribosomal protein L14
  • ribosomal protein L14
  • RL14

Background

RPL14 - ribosomal protein L14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
MAB8164
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006202-Q01
Species: Hu
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-06930
Species: Hu
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
H00006218-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC

Publications for RPL14 Partial Recombinant Protein (H00009045-Q01) (0)

There are no publications for RPL14 Partial Recombinant Protein (H00009045-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL14 Partial Recombinant Protein (H00009045-Q01) (0)

There are no reviews for RPL14 Partial Recombinant Protein (H00009045-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL14 Partial Recombinant Protein (H00009045-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for RPL14 Partial Recombinant Protein (H00009045-Q01)

Discover related pathways, diseases and genes to RPL14 Partial Recombinant Protein (H00009045-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL14 Partial Recombinant Protein (H00009045-Q01)

Discover more about diseases related to RPL14 Partial Recombinant Protein (H00009045-Q01).
 

Pathways for RPL14 Partial Recombinant Protein (H00009045-Q01)

View related products by pathway.

Blogs on RPL14

There are no specific blogs for RPL14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL14 Antibody
NBP1-85385
RPS5 Antibody (4H3)
H00006193-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPL14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL14