RNF122 Antibody (5E5) - Azide and BSA Free

Western Blot: RNF122 Antibody (5E5) [H00079845-M01] - Analysis of RNF122 expression in transfected 293T cell line by RNF122 monoclonal antibody (M01), clone 5E5.Lane 1: RNF122 transfected lysate(17.475 KDa).Lane 2: Non-transfected lysate.

ELISA: RNF122 Antibody (5E5) [H00079845-M01] - Detection limit for recombinant GST tagged RNF122 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5E5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF122 Antibody (5E5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RNF122 Antibody (5E5) - Azide and BSA Free (H00079845-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RNF122 (NP_079063, 61 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV
• Specificity: RNF122 - ring finger protein 122
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNF122
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF122 Antibody (5E5) - Azide and BSA Free

• FLJ12526
• MGC126622
• ring finger protein 122

Background

The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF122
• Entrez:
  • 79845(Human)
• Uniprot:
  • NP_079063(Human)