Recombinant Human RIOK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RIOK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 453-551 of Human RIOK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RIOK2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RIOK2 Protein

  • EC 2.7.11.1
  • FLJ11159
  • RIO kinase 2 (yeast)
  • RIO kinase 2
  • RIO2
  • serine/threonine-protein kinase RIO2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13663
Species: Hu
Applications: IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
H00054957-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86734
Species: Hu
Applications: WB, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-84619
Species: Hu
Applications: WB, IHC, IHC-P
H00056902-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58953
Species: Hu
Applications: ICC/IF
NBP2-30659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-90676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-31598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
H00055781-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RIOK2 Partial Recombinant Protein (H00055781-Q01) (0)

There are no publications for RIOK2 Partial Recombinant Protein (H00055781-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIOK2 Partial Recombinant Protein (H00055781-Q01) (0)

There are no reviews for RIOK2 Partial Recombinant Protein (H00055781-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIOK2 Partial Recombinant Protein (H00055781-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIOK2 Products

Bioinformatics Tool for RIOK2 Partial Recombinant Protein (H00055781-Q01)

Discover related pathways, diseases and genes to RIOK2 Partial Recombinant Protein (H00055781-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RIOK2 Partial Recombinant Protein (H00055781-Q01)

View related products by pathway.

Research Areas for RIOK2 Partial Recombinant Protein (H00055781-Q01)

Find related products by research area.

Blogs on RIOK2

There are no specific blogs for RIOK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CRM1 Antibody
NB100-79802
CRIPTO Antibody
NB100-1598

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RIOK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RIOK2