RING1 Recombinant Protein Antigen

Images

 
There are currently no images for RING1 Protein (NBP1-80830PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RING1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RING1.

Source: E. coli

Amino Acid Sequence: TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RING1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80830. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RING1 Recombinant Protein Antigen

  • EC 6.3.2
  • EC 6.3.2.-
  • Polycomb complex protein RING1
  • Really interesting new gene 1 protein
  • ring finger protein 1RING1A
  • RING1
  • RNF1
  • RNF1E3 ubiquitin-protein ligase RING1

Background

RING1 belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006045-M01
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF4767
Species: Hu, Mu
Applications: ICC, WB
AF5827
Species: Hu, Mu
Applications: WB
NBP2-02009
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84620
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-37371
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP1-84309
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1240
Species: Hu
Applications: PEP-ELISA, WB
NBP2-29421
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
AF1556
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF4885
Species: Mu
Applications: IP, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for RING1 Protein (NBP1-80830PEP) (0)

There are no publications for RING1 Protein (NBP1-80830PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RING1 Protein (NBP1-80830PEP) (0)

There are no reviews for RING1 Protein (NBP1-80830PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RING1 Protein (NBP1-80830PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RING1 Products

Research Areas for RING1 Protein (NBP1-80830PEP)

Find related products by research area.

Blogs on RING1

There are no specific blogs for RING1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RING1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RING1