RIC8A Antibody (1H6) - Azide and BSA Free Summary
| Immunogen |
RIC8A (NP_068751.4, 462 a.a. ~ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
RIC8A |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RIC8A Antibody (1H6) - Azide and BSA Free
Background
RIC8 is a likely orthalog of mouse Synembryn. Synembryns are proteins that positively regulate synaptic transmission. They are actively required to maintain proper activity of the Go to Gq G-protein signalling network, which regulates neurotransmitter secretion in Caenorhabditis elegans by controlling the production and consumption of diacylglycerol. In addition to its role in the adult nervous system, synembryn is required to regulate a subset of centrosome movements in the early C. elegans embryo.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Publications for RIC8A Antibody (H00060626-M01-100ug) (0)
There are no publications for RIC8A Antibody (H00060626-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RIC8A Antibody (H00060626-M01-100ug) (0)
There are no reviews for RIC8A Antibody (H00060626-M01-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RIC8A Antibody (H00060626-M01-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RIC8A Products
Array H00060626-M01-100ug
Blogs on RIC8A