RIC8A Antibody (1H6) - Azide and BSA Free

ELISA: RIC8A Antibody (1H6) [H00060626-M01-100ug] - Detection limit for recombinant GST tagged RIC8A is 0.03 ng/ml as a capture antibody.

RIC8A Antibody (1H6) [H00060626-M01-100ug] - Analysis of RIC8A expression in K-562.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1H6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RIC8A Antibody (1H6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RIC8A Antibody (1H6) - Azide and BSA Free (H00060626-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RIC8A (NP_068751.4, 462 a.a. ~ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RIC8A
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RIC8A Antibody (1H6) - Azide and BSA Free

• RIC8
• RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
• synembryn
• synembryn-A

Background

RIC8 is a likely orthalog of mouse Synembryn. Synembryns are proteins that positively regulate synaptic transmission. They are actively required to maintain proper activity of the Go to Gq G-protein signalling network, which regulates neurotransmitter secretion in Caenorhabditis elegans by controlling the production and consumption of diacylglycerol. In addition to its role in the adult nervous system, synembryn is required to regulate a subset of centrosome movements in the early C. elegans embryo.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RIC8A
• Entrez:
  • 60626(Human)
• OMIM:
  • 609146(Human)
• Uniprot:
  • NP_068751.4(Human)