RGS2 Recombinant Protein Antigen

Images

 
There are currently no images for RGS2 Recombinant Protein Antigen (NBP2-55551PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RGS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to RGS2.

Source: E. coli

Amino Acid Sequence: KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RGS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55551.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RGS2 Recombinant Protein Antigen

  • Cell growth-inhibiting gene 31 protein
  • G0 to G1 switch regulatory 8, 24kD
  • G0/G1 switch regulatory protein 8
  • G0S8cell growth-inhibiting protein 31
  • regulator of G-protein signaling 2
  • regulator of G-protein signaling 2, 24kDa
  • regulator of G-protein signalling 2, 24kD
  • regulator of G-protein signalling 2, 24kDa

Background

Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1029
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-00880
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00005998-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P
NLS418
Species: Hu
Applications: IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
NBP2-01584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55551PEP
Species: Hu
Applications: AC

Publications for RGS2 Recombinant Protein Antigen (NBP2-55551PEP) (0)

There are no publications for RGS2 Recombinant Protein Antigen (NBP2-55551PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS2 Recombinant Protein Antigen (NBP2-55551PEP) (0)

There are no reviews for RGS2 Recombinant Protein Antigen (NBP2-55551PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RGS2 Recombinant Protein Antigen (NBP2-55551PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS2 Products

Research Areas for RGS2 Recombinant Protein Antigen (NBP2-55551PEP)

Find related products by research area.

Blogs on RGS2

There are no specific blogs for RGS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RGS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS2