Recombinant Human RFC3 Protein

Images

 
SDS-Page: Recombinant Human RFC3 Protein [H00005983-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human RFC3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-356 of Human RFC3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQGDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCGGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
RFC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
64.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RFC3 Protein

  • A1 38 kDa subunit
  • Activator 1 38 kDa subunit
  • Activator 1 subunit 3
  • MGC5276
  • replication factor C (activator 1) 3 (38kD)
  • replication factor C (activator 1) 3, 38kDa
  • Replication factor C 38 kDa subunit
  • replication factor C subunit 3
  • RFC, 38 kD subunit
  • RFC38RF-C 38 kDa subunit

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6457
Species: Hu
Applications: WB
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-87137
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-38124
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
409-ML/CF
Species: Mu
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58005
Species: Hu
Applications: WB, IHC, IHC-P
H00005983-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for RFC3 Recombinant Protein (H00005983-P01) (0)

There are no publications for RFC3 Recombinant Protein (H00005983-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC3 Recombinant Protein (H00005983-P01) (0)

There are no reviews for RFC3 Recombinant Protein (H00005983-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFC3 Recombinant Protein (H00005983-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for RFC3 Recombinant Protein (H00005983-P01)

Discover related pathways, diseases and genes to RFC3 Recombinant Protein (H00005983-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC3 Recombinant Protein (H00005983-P01)

Discover more about diseases related to RFC3 Recombinant Protein (H00005983-P01).
 

Pathways for RFC3 Recombinant Protein (H00005983-P01)

View related products by pathway.

PTMs for RFC3 Recombinant Protein (H00005983-P01)

Learn more about PTMs related to RFC3 Recombinant Protein (H00005983-P01).
 

Research Areas for RFC3 Recombinant Protein (H00005983-P01)

Find related products by research area.

Blogs on RFC3

There are no specific blogs for RFC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RFC3 Antibody
NBP1-82668

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RFC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC3