RFC3 Antibody

Images

 
Western Blot: RFC3 Antibody [H00005983-B02P] - Analysis of RFC3 expression in transfected 293T cell line by RFC3 polyclonal antibody. Lane 1: RFC3 transfected lysate(40.60 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: RFC3 Antibody [H00005983-B02P] - Analysis of purified antibody to RFC3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: RFC3 Antibody [H00005983-B02P] - Expression in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RFC3 Antibody Summary

Immunogen
RFC3 (NP_002906.1, 1 a.a. - 356 a.a.) full-length human protein. MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RFC3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFC3 Antibody

  • A1 38 kDa subunit
  • Activator 1 38 kDa subunit
  • Activator 1 subunit 3
  • MGC5276
  • replication factor C (activator 1) 3 (38kD)
  • replication factor C (activator 1) 3, 38kDa
  • Replication factor C 38 kDa subunit
  • replication factor C subunit 3
  • RFC, 38 kD subunit
  • RFC38RF-C 38 kDa subunit

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 38 kD subunit. This subunit is essential for the interaction between the 140 kD subunit and the core complex that consists of the 36, 37, and 40 kD subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56070
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-235
Species: Hu
Applications: WB, PLA
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
409-ML/CF
Species: Mu
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55454
Species: Hu
Applications: WB, ICC/IF
H00005983-B02P
Species: Hu
Applications: WB, ICC/IF

Publications for RFC3 Antibody (H00005983-B02P) (0)

There are no publications for RFC3 Antibody (H00005983-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC3 Antibody (H00005983-B02P) (0)

There are no reviews for RFC3 Antibody (H00005983-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RFC3 Antibody (H00005983-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFC3 Products

Bioinformatics Tool for RFC3 Antibody (H00005983-B02P)

Discover related pathways, diseases and genes to RFC3 Antibody (H00005983-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC3 Antibody (H00005983-B02P)

Discover more about diseases related to RFC3 Antibody (H00005983-B02P).
 

Pathways for RFC3 Antibody (H00005983-B02P)

View related products by pathway.

PTMs for RFC3 Antibody (H00005983-B02P)

Learn more about PTMs related to RFC3 Antibody (H00005983-B02P).
 

Research Areas for RFC3 Antibody (H00005983-B02P)

Find related products by research area.

Blogs on RFC3

There are no specific blogs for RFC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC3
Uniprot