![Western Blot: REEP2 Antibody [H00051308-B01P] - Analysis of REEP2 expression in transfected 293T cell line by REEP2 polyclonal antibody. Lane 1: C5orf19 transfected lysate(27.83 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/REEP2-Antibody-Western-Blot-H00051308-B01P-img0002.jpg "Western Blot: REEP2 Antibody [H00051308-B01P] - Analysis of REEP2 expression in transfected 293T cell line by REEP2 polyclonal antibody. Lane 1: C5orf19 transfected lysate(27.83 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse REEP2 Antibody - Azide and BSA Free (H00051308-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | C5orf19 (AAH06218, 1 a.a. - 252 a.a.) full-length human protein. MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA |
| Specificity | C5orf19 - chromosome 5 open reading frame 19, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | REEP2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for REEP2 Antibody (H00051308-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Slit2 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Slit2 [Unconjugated]")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")