RCCD1 Antibody - BSA Free

Western Blot: RCCD1 Antibody [NBP1-93518] - Analysis in control (vector only transfected HEK293T lysate) and RCCD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: RCCD1 Antibody [NBP1-93518] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: RCCD1 Antibody [NBP1-93518] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: RCCD1 Antibody [NBP1-93518] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RCCD1 Antibody [NBP1-93518] - Staining of human fallopian tube, skin, small intestine and testis using Anti-RCCD1 antibody NBP1-93518 (A) shows similar protein distribution across tissues to independent antibody NBP1-93517 (B).

Immunohistochemistry-Paraffin: RCCD1 Antibody [NBP1-93518] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: RCCD1 Antibody [NBP1-93518] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and RCCD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RCCD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVTCGPWNTYVYAVEKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCCD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RCCD1 Protein (NBP1-93518PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RCCD1 Antibody - BSA Free

• MGC14386
• RCC1 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCCD1