RBM33 Antibody - BSA Free

Western Blot: RBM33 Antibody [NBP1-84200] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: RBM33 Antibody [NBP1-84200] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Western Blot: RBM33 Antibody [NBP1-84200] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-465

Immunohistochemistry-Paraffin: RBM33 Antibody [NBP1-84200] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: RBM33 Antibody [NBP1-84200] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: RBM33 Antibody [NBP1-84200] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: RBM33 Antibody [NBP1-84200] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM33 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QHPPQHQHHHHHHHLSVPPPPLMPMSQPQFRPHVQTAQPQASSSRMQCPQRQGLRHNTTSQNVSKRPMQQMQPTAPRNSNLREL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM33
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM33 Protein (NBP1-84200PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM33 Antibody - BSA Free

• DKFZp434D1319
• MGC20460
• proline-rich protein 8
• RNA binding motif protein 33
• RNA-binding motif protein 33
• RNA-binding protein 33

Background

The RBM33 gene encodes a RNA-binding protein 33 that in isoform 1 is 1,170 amino acids long and nearly 130 kDA and in isoform 2 is 268 amino acids long at 30 kDA. RBM33 interacts with genes: TERF1, TERF2, GRB2, SUMO1, and SUMO3. It has been researched regarding its role in filariasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM33 Antibody (NBP1-84200)(1)

Publication using NBP1-84200

• Chen W, Pilling D, Gomer RH The mRNA binding protein DDX3 mediates TGF-?1 upregulation of translation and promotes pulmonary fibrosis JCI insight 2023-02-23 [PMID: 36821384] (WB, IHC-Fr, Human, Mouse)

Bioinformatics

• Gene Symbol: RBM33