RAMP2 Recombinant Protein Antigen

Images

 
There are currently no images for RAMP2 Recombinant Protein Antigen (NBP2-58104PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RAMP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAMP2.

Source: E. coli

Amino Acid Sequence: PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAMP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58104.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAMP2 Recombinant Protein Antigen

  • calcitonin receptor-like receptor activity modifying protein 2
  • Calcitonin-receptor-like receptor activity-modifying protein 2
  • CRLR activity-modifying protein 2
  • RAMP2
  • receptor (calcitonin) activity modifying protein 2
  • receptor (G protein-coupled) activity modifying protein 2
  • receptor activity modifying protein 2
  • receptor activity-modifying protein 2
  • receptor-activity-modifying protein 2

Background

The protein encoded by the RAMP2 gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC,  IHC-P
AF4875
Species: Hu
Applications: WB
AF6428
Species: Hu
Applications: IHC, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-84685
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF6517
Species: Hu
Applications: WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NBP1-77129
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
DVE00
Species: Hu
Applications: ELISA
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC

Publications for RAMP2 Recombinant Protein Antigen (NBP2-58104PEP) (0)

There are no publications for RAMP2 Recombinant Protein Antigen (NBP2-58104PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAMP2 Recombinant Protein Antigen (NBP2-58104PEP) (0)

There are no reviews for RAMP2 Recombinant Protein Antigen (NBP2-58104PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RAMP2 Recombinant Protein Antigen (NBP2-58104PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAMP2 Products

Blogs on RAMP2

There are no specific blogs for RAMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RAMP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAMP2