RALYL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RALYL Antibody [NBP2-56158] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RALYL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSD
Specificity
Specificity of human RALYL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RALYL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RALYL Recombinant Protein Antigen (NBP2-56158PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RALYL Antibody

  • hnRNP core protein C-like 3
  • HNRPCL3Heterogeneous nuclear ribonucleoprotein C-like 3
  • hRALYL
  • RALY RNA binding protein-like
  • RNA-binding Raly-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56091
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-20522
Species: Hu
Applications: WB, ICC/IF, IP
H00051099-M01
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KO
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47316
Species: Hu
Applications: WB (-), IHC, IP
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce, I, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001040-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-97493
Species: Hu, Mu, Rt, Eq, Fi, Rb
Applications: WB, EIA, IHC, IHC-P

Publications for RALYL Antibody (NBP2-56158) (0)

There are no publications for RALYL Antibody (NBP2-56158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALYL Antibody (NBP2-56158) (0)

There are no reviews for RALYL Antibody (NBP2-56158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RALYL Antibody (NBP2-56158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RALYL Products

Bioinformatics Tool for RALYL Antibody (NBP2-56158)

Discover related pathways, diseases and genes to RALYL Antibody (NBP2-56158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RALYL Antibody (NBP2-56158)

Discover more about diseases related to RALYL Antibody (NBP2-56158).
 

Pathways for RALYL Antibody (NBP2-56158)

View related products by pathway.

Blogs on RALYL

There are no specific blogs for RALYL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RALYL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RALYL