Recombinant Human RALGPS2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RALGPS2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 282-386 of Human RALGPS2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQA

Protein/Peptide Type
Partial Recombinant Protein
Gene
RALGPS2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RALGPS2 Protein

  • dJ595C2.1
  • FLJ10244
  • FLJ25604
  • KIAA0351
  • Ral GEF with PH domain and SH3 binding motif 2
  • Ral GEF with PH domain and SH3-binding motif 2
  • RalA exchange factor RalGPS2
  • Ral-A exchange factor RalGPS2
  • ras-specific guanine nucleotide-releasing factor RalGPS2

Background

RALGPS2 - Ral GEF with PH domain and SH3 binding motif 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-57057
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4208
Species: Rt
Applications: WB
AF7318
Species: Hu
Applications: IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
640-A3
Species: Mu
AF5480
Species: Hu
Applications: IHC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP1-90530
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00055103-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RALGPS2 Partial Recombinant Protein (H00055103-Q01) (0)

There are no publications for RALGPS2 Partial Recombinant Protein (H00055103-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALGPS2 Partial Recombinant Protein (H00055103-Q01) (0)

There are no reviews for RALGPS2 Partial Recombinant Protein (H00055103-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RALGPS2 Partial Recombinant Protein (H00055103-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RALGPS2 Products

Bioinformatics Tool for RALGPS2 Partial Recombinant Protein (H00055103-Q01)

Discover related pathways, diseases and genes to RALGPS2 Partial Recombinant Protein (H00055103-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RALGPS2 Partial Recombinant Protein (H00055103-Q01)

Discover more about diseases related to RALGPS2 Partial Recombinant Protein (H00055103-Q01).
 

Pathways for RALGPS2 Partial Recombinant Protein (H00055103-Q01)

View related products by pathway.

Research Areas for RALGPS2 Partial Recombinant Protein (H00055103-Q01)

Find related products by research area.

Blogs on RALGPS2

There are no specific blogs for RALGPS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RALGPS2 Antibody
NBP1-84645

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RALGPS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RALGPS2