Recombinant Human RABL4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RABL4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-186 of Human RABL4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Protein/Peptide Type
Recombinant Protein
Gene
IFT27

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 150 mM NaCl, pH 7.5, 0.25 mM Dithiothreitol, 0.1 mM EGTA, 0.1 mM EDTA, 25% glycerol, 0.1 mM PMSF

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RABL4 Protein

  • intraflagellar transport 27 homolog (Chlamydomonas)
  • intraflagellar transport protein 27 homolog
  • member of RAS oncogene family-like 4
  • Putative GTP-binding protein RAY-like
  • RABL4
  • Rab-like protein 4

Background

This gene encodes a putative GTP-binding protein similar to RAY/RAB1C. The protein is ras-related, but the function is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NBP1-88332
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22411
Species: Rt
Applications: WB, ICC/IF
NB300-822
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-55756
Species: Hu
Applications: IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP2-16927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86424
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF873
Species: Hu
Applications: WB
NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90686
Species: Hu
Applications: IHC, IHC-P
H00011020-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RABL4 Recombinant Protein (H00011020-P01) (0)

There are no publications for RABL4 Recombinant Protein (H00011020-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABL4 Recombinant Protein (H00011020-P01) (0)

There are no reviews for RABL4 Recombinant Protein (H00011020-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABL4 Recombinant Protein (H00011020-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RABL4 Products

Bioinformatics Tool for RABL4 Recombinant Protein (H00011020-P01)

Discover related pathways, diseases and genes to RABL4 Recombinant Protein (H00011020-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABL4 Recombinant Protein (H00011020-P01)

Discover more about diseases related to RABL4 Recombinant Protein (H00011020-P01).
 

Pathways for RABL4 Recombinant Protein (H00011020-P01)

View related products by pathway.

PTMs for RABL4 Recombinant Protein (H00011020-P01)

Learn more about PTMs related to RABL4 Recombinant Protein (H00011020-P01).
 

Research Areas for RABL4 Recombinant Protein (H00011020-P01)

Find related products by research area.

Blogs on RABL4

There are no specific blogs for RABL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RABL4 Antibody
NBP1-87170
Kif2a Antibody
NB500-180

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RABL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT27