RABL4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RABL4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RABL4
  
  

  Source: E.coli

  Amino Acid Sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IFT27
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25088It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RABL4 Recombinant Protein Antigen

• intraflagellar transport 27 homolog (Chlamydomonas)
• intraflagellar transport protein 27 homolog
• member of RAS oncogene family-like 4
• Putative GTP-binding protein RAY-like
• RABL4
• Rab-like protein 4

Background

Belonging to the small GTPase superfamily/Ras family, RABL4 possesses GTPase activity. More specifically, RABL4 encodes a GTP-binding protein that is a main component of the intraflagellar transport complex B. RABL4 interacts with HSPB11, AXIN2, CSNK1A1, CSNK1E and GSK3B. Biological processes associated with RABL4 include cilium assembly, kidney development and small GTPase mediated signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFT27