Novus Biologicals products are now on bio-techne.com

Rabenosyn 5 Recombinant Protein Antigen

Images

 
There are currently no images for Rabenosyn 5 Recombinant Protein Antigen (NBP1-92310PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rabenosyn 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFYVE20.

Source: E. coli

Amino Acid Sequence: DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBSN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92310.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rabenosyn 5 Recombinant Protein Antigen

  • 110 kDa protein
  • FLJ34993
  • FYVE finger-containing Rab5 effector protein rabenosyn-5
  • FYVE-finger-containing Rab5 effector protein rabenosyn-5
  • MGC126210
  • Rabenosyn-5
  • ZFYVE20
  • Zinc finger FYVE domain-containing protein 20
  • zinc finger, FYVE domain containing 20

Background

DNA binding protein involved in regulation of transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
2496-ZN
Species: Hu
Applications: EnzAct
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-98931
Species: Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP3-22015
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NB100-282
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00004948-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for Rabenosyn 5 Recombinant Protein Antigen (NBP1-92310PEP) (0)

There are no publications for Rabenosyn 5 Recombinant Protein Antigen (NBP1-92310PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rabenosyn 5 Recombinant Protein Antigen (NBP1-92310PEP) (0)

There are no reviews for Rabenosyn 5 Recombinant Protein Antigen (NBP1-92310PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rabenosyn 5 Recombinant Protein Antigen (NBP1-92310PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rabenosyn 5 Products

Blogs on Rabenosyn 5

There are no specific blogs for Rabenosyn 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rab5a Antibody
NB120-13253

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rabenosyn 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBSN