RAB36 Antibody

Images

 
Western Blot: RAB36 Antibody [NBP2-84234] - Host: Rabbit. Target Name: RAB36. Sample Tissue: Human Du145 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB36 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB36. Peptide sequence: FDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RAB36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB36 Antibody

  • RAB36, member RAS oncogene family
  • ras-related protein Rab-36
  • small GTP-binding protein Rab36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86045
Species: Hu
Applications: IHC, IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88111
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1205
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-85576
Species: Hu
Applications: WB
NBP1-49643
Species: Bv, Hu, Pm, Mu
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
7268-CT
Species: Hu
Applications: BA
AF5687
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
AF6525
Species: Hu
Applications: WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
NBP1-87172
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-84234
Species: Hu
Applications: WB

Publications for RAB36 Antibody (NBP2-84234) (0)

There are no publications for RAB36 Antibody (NBP2-84234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB36 Antibody (NBP2-84234) (0)

There are no reviews for RAB36 Antibody (NBP2-84234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB36 Antibody (NBP2-84234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB36 Products

Bioinformatics Tool for RAB36 Antibody (NBP2-84234)

Discover related pathways, diseases and genes to RAB36 Antibody (NBP2-84234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB36 Antibody (NBP2-84234)

Discover more about diseases related to RAB36 Antibody (NBP2-84234).
 

Pathways for RAB36 Antibody (NBP2-84234)

View related products by pathway.

Research Areas for RAB36 Antibody (NBP2-84234)

Find related products by research area.

Blogs on RAB36

There are no specific blogs for RAB36, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB36