Home » RAB36 » RAB36 Antibodies » RAB36 Antibody

RAB36 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RAB36 Antibody [NBP2-84234] - Host: Rabbit. Target Name: RAB36. Sample Tissue: Human Du145 Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: RAB36 Antibody [NBP2-84234] - Host: Rabbit. Target Name: RAB36. Sample Tissue: Human Du145 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Product Discontinued
View other related RAB36 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-84234
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RAB36 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB36. Peptide sequence: FDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RAB36
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for RAB36 Antibody

  • RAB36, member RAS oncogene family
  • ras-related protein Rab-36
  • small GTP-binding protein Rab36

Background

Protein transport. Probably involved in vesicular traffic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RTDR1 Antibody -
BSA Free
NBP1-86045
Western Blot RTDR1 Antibody - BSA Free
Immunohistochemistry-Paraffin RTDR1 Antibody - BSA Free
Immunohistochemistry-Paraffin RTDR1 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
GM130/GOLGA2
Antibody - BSA Free
NBP2-53420
Flow Cytometry GM130/GOLGA2 Antibody - BSA Free
Flow Cytometry GM130/GOLGA2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GM130/GOLGA2 Antibody - BSA Free
(22 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
PRICKLE1 Antibody
- BSA Free
NBP2-81771
Western Blot PRICKLE1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRICKLE1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
HIV-1 Rev binding
protein Antibody - BS ...
NBP1-91991
Immunocytochemistry/ Immunofluorescence HIV-1 Rev binding protein Antibody - BSA Free
Western Blot HIV-1 Rev binding protein Antibody - BSA Free
Immunohistochemistry-Paraffin HIV-1 Rev binding protein Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
G Protein alpha z
Antibody - BSA Free
NBP1-88111
Immunocytochemistry/ Immunofluorescence G Protein alpha z Antibody - BSA Free
Immunohistochemistry-Paraffin G Protein alpha z Antibody - BSA Free
Immunohistochemistry-Paraffin G Protein alpha z Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
JNK1/2/3 [p
Thr183, p Tyr185] Ant ...
AF1205
Western Blot JNK1/2/3 [p Thr183, p Tyr185] Antibody [Unconjugated]
Simple Western JNK1/2/3 [p Thr183, p Tyr185] Antibody [Unconjugated]
Immunohistochemistry JNK1/2/3 [p Thr183, p Tyr185] Antibody [Unconjugated]
(1 Review)
(25 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
RAB34 Antibody -
BSA Free
NBP3-46828
Immunohistochemistry RAB34 Antibody - BSA Free
Western Blot RAB34 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
TGN46 Antibody -
BSA Free
NBP1-49643
Flow (Intracellular) TGN46 Antibody - BSA Free
Flow (Intracellular) TGN46 Antibody - BSA Free
Immunohistochemistry TGN46 Antibody - BSA Free
(2 Reviews)
(36 Publications)
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, KO, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Syntaxin 5
Antibody [Unconjugate
AF5687
Simple Western Syntaxin 5 Antibody [Unconjugated]
Western Blot Syntaxin 5 Antibody [Unconjugated]
Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
Ig Lambda C
Domain/IGLC2 Antibody
AF6525
Western Blot Ig Lambda C Domain/IGLC2 Antibody
Species: Hu
Applications: WB
EEA1 Antibody
(6D4.1D4) - BSA Free
NBP2-36568
Flow (Intracellular) EEA1 Antibody (6D4.1D4) - BSA Free
Immunohistochemistry-Paraffin EEA1 Antibody (6D4.1D4) - BSA Free
Immunohistochemistry-Paraffin EEA1 Antibody (6D4.1D4) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
RAB9A Antibody
(7O1G4)
NBP3-16506
Immunohistochemistry-Paraffin RAB9A Antibody (7O1G4)
Western Blot RAB9A Antibody (7O1G4)
Immunocytochemistry/ Immunofluorescence RAB9A Antibody (7O1G4)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
Neurofibromin 1
Antibody - BSA Free
NB300-155
Immunohistochemistry Neurofibromin 1 Antibody - BSA Free
Western Blot Neurofibromin 1 Antibody - BSA Free
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
RAB36 Antibody
NBP2-84234
RAB36 Antibody
Species: Hu
Applications: WB

Publications for RAB36 Antibody (NBP2-84234) (0)

There are no publications for RAB36 Antibody (NBP2-84234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB36 Antibody (NBP2-84234) (0)

There are no reviews for RAB36 Antibody (NBP2-84234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB36 Antibody (NBP2-84234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB36 Products

Research Areas for RAB36 Antibody (NBP2-84234)

Find related products by research area.

Blogs on RAB36

There are no specific blogs for RAB36, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB36 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RAB36