PUS7 Antibody

Images

 
Western Blot: PUS7 Antibody [NBP1-83652] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: PUS7 Antibody [NBP1-83652] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: PUS7 Antibody [NBP1-83652] - Staining of human testis shows strong nuclear positivity in germ cells and Leydig cells.
Western Blot: PUS7 Antibody [NBP1-83652] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PUS7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGFDVIYPKHKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PUS7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PUS7 Protein (NBP1-83652PEP)
Publications
Read Publication using NBP1-83652.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25755260)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PUS7 Antibody

  • EC 5.4.99.-
  • FLJ20485
  • KIAA1897
  • MGC17720
  • pseudouridylate synthase 7 homolog (S. cerevisiae)
  • pseudouridylate synthase 7 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83652
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PUS7 Antibody (NBP1-83652)(1)

We have publications tested in 2 applications: ChIP, WB.


Filter By Application
ChIP
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for PUS7 Antibody (NBP1-83652) (0)

There are no reviews for PUS7 Antibody (NBP1-83652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PUS7 Antibody (NBP1-83652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PUS7 Products

Bioinformatics Tool for PUS7 Antibody (NBP1-83652)

Discover related pathways, diseases and genes to PUS7 Antibody (NBP1-83652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PUS7 Antibody (NBP1-83652)

View related products by pathway.

Blogs on PUS7

There are no specific blogs for PUS7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUS7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PUS7