PTGER4/EP4 Antibody


Western Blot: PTGER4/EP4 Antibody [NBP1-84833] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: PTGER4/EP4 Antibody [NBP1-84833] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: PTGER4/EP4 Antibody [NBP1-84833] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PTGER4/EP4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMV
Specificity of human, mouse PTGER4/EP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PTGER4/EP4 Protein (NBP1-84833PEP)
Read Publications using
NBP1-84833 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23227994)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PTGER4/EP4 Antibody

  • EP4
  • EP4R
  • MGC126583
  • PGE receptor EP4 subtype
  • PGE receptor, EP4 subtype
  • PGE2 receptor EP4 subtype
  • prostaglandin E receptor 4 (subtype EP4)
  • prostaglandin E2 receptor EP4 subtype
  • Prostanoid EP4 receptor
  • PTGER2
  • PTGER4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PTGER4/EP4 Antibody (NBP1-84833)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PTGER4/EP4 Antibody (NBP1-84833) (0)

There are no reviews for PTGER4/EP4 Antibody (NBP1-84833). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTGER4/EP4 Antibody (NBP1-84833) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PTGER4/EP4 Products

Bioinformatics Tool for PTGER4/EP4 Antibody (NBP1-84833)

Discover related pathways, diseases and genes to PTGER4/EP4 Antibody (NBP1-84833). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTGER4/EP4 Antibody (NBP1-84833)

Discover more about diseases related to PTGER4/EP4 Antibody (NBP1-84833).

Pathways for PTGER4/EP4 Antibody (NBP1-84833)

View related products by pathway.

PTMs for PTGER4/EP4 Antibody (NBP1-84833)

Learn more about PTMs related to PTGER4/EP4 Antibody (NBP1-84833).

Research Areas for PTGER4/EP4 Antibody (NBP1-84833)

Find related products by research area.

Blogs on PTGER4/EP4

There are no specific blogs for PTGER4/EP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PTGER4/EP4 Antibody and receive a gift card or discount.


Gene Symbol PTGER4