PTGER4/EP4 Antibody

Western Blot: PTGER4/EP4 Antibody [NBP1-84833] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: PTGER4/EP4 Antibody [NBP1-84833] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.

Western Blot: PTGER4/EP4 Antibody [NBP1-84833] - Analysis in human cell line RT-4.

Immunohistochemistry-Paraffin: PTGER4/EP4 Antibody [NBP1-84833] - Staining of human fallopian tube shows moderate to strong membranous positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: PTGER4/EP4 Antibody [NBP1-84833] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PTGER4/EP4 Antibody [NBP1-84833] - Staining of human liver shows very weak membranous positivity in hepatocytes.

Product Discontinued

PTGER4/EP4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGER4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 29415894). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23227994).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTGER4/EP4 Antibody

• EP4
• EP4R
• MGC126583
• PGE receptor EP4 subtype
• PGE receptor, EP4 subtype
• PGE2 receptor EP4 subtype
• prostaglandin E receptor 4 (subtype EP4)
• prostaglandin E2 receptor EP4 subtype
• Prostanoid EP4 receptor
• PTGER2
• PTGER4

Background

Prostaglandin E receptor EP4 is a Prostanoid Receptor with a relaxing effect on smooth muscle. It may play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. EP4 has been reported to be expressed in blood, colon, immune tissue, intestine, kidney, lung, ovary, skin, and uterus. ESTs have been isolated from a wide range of human tissue libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTGER4/EP4 Antibody (NBP1-84833)(4)

Publications using NBP1-84833

• Lone AM, Giansanti P, Jrgensen MJ Et al. Systems approach reveals distinct and shared signaling networks of the four PGE2 receptors in T cells Science signaling 2021-10-05 [PMID: 34609894]
• He X, Smith SE, Chen S et al. Tumor-initiating stem cell shapes its microenvironment into an immunosuppressive barrier and pro-tumorigenic niche Cell reports 2021-09-07 [PMID: 34496236]
• Rahman MJ, Rodrigues KB, Quiel JA, Liu Y. Restoration of the type I IFN-IL-1 balance through targeted blockade of PTGER4 inhibits autoimmunity in NOD mice. JCI Insight. 2018-02-08 [PMID: 29415894] (WB, Mouse)
• Oll M, Baumann C, Behbahani TE et al. Identification of prostaglandin receptors in human ureters. BMC Urol 2012-12-10 [PMID: 23227994]

Bioinformatics

• Gene Symbol: PTGER4
• Entrez:
  • 5734(Human)
• Uniprot:
  • P35408(Human)