PSTK Antibody

Images

 
Western Blot: PSTK Antibody [NBP1-70690] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSTK Antibody Summary

Immunogen
Synthetic peptides corresponding to PSTK(phosphoseryl-tRNA kinase) The peptide sequence was selected from the middle region of PSTK. Peptide sequence SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSTK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PSTK and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PSTK Antibody

  • phosphoseryl-tRNA kinase

Background

PSTK specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83992
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
AF3749
Species: Hu
Applications: WB, IHC
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-13293
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24696
Species: Hu
Applications: IHC-P
NBP1-88751
Species: Hu
Applications: IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37573
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, IHC
NBP1-70690
Species: Hu
Applications: WB

Publications for PSTK Antibody (NBP1-70690) (0)

There are no publications for PSTK Antibody (NBP1-70690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSTK Antibody (NBP1-70690) (0)

There are no reviews for PSTK Antibody (NBP1-70690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSTK Antibody (NBP1-70690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSTK Products

Bioinformatics Tool for PSTK Antibody (NBP1-70690)

Discover related pathways, diseases and genes to PSTK Antibody (NBP1-70690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSTK Antibody (NBP1-70690)

Discover more about diseases related to PSTK Antibody (NBP1-70690).
 

Pathways for PSTK Antibody (NBP1-70690)

View related products by pathway.

PTMs for PSTK Antibody (NBP1-70690)

Learn more about PTMs related to PSTK Antibody (NBP1-70690).

Blogs on PSTK

There are no specific blogs for PSTK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSTK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSTK