We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human PSMD8 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human PSMD8 Protein [H00005714-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human PSMD8 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-257 of Human PSMD8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PSMD8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
53.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PSMD8 GST (N-Term) Protein

  • 26S proteasome non-ATPase regulatory subunit 8
  • 26S proteasome regulatory subunit p31
  • HIP6,26S proteasome regulatory subunit S14
  • HYPF
  • MGC1660
  • Nin1p
  • p3126S proteasome regulatory subunit RPN12
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
  • Rpn12
  • S14

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. PSMD8( NP_002803, 1 a.a. - 258 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-01808
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NBP1-33691
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
H00006223-M01
Species: Hu, Mu
Applications: ELISA, WB
NBP1-81545
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-22288
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80961
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-46656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB

Publications for PSMD8 Recombinant Protein (H00005714-P01) (0)

There are no publications for PSMD8 Recombinant Protein (H00005714-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD8 Recombinant Protein (H00005714-P01) (0)

There are no reviews for PSMD8 Recombinant Protein (H00005714-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMD8 Recombinant Protein (H00005714-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMD8 Products

Research Areas for PSMD8 Recombinant Protein (H00005714-P01)

Find related products by research area.

Blogs on PSMD8

There are no specific blogs for PSMD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PSMD8 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD8