PRTFDC1 Antibody

Product Discontinued

PRTFDC1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PRTFDC1(phosphoribosyl transferase domain containing 1) The peptide sequence was selected from the N terminal of PRTFDC1. Peptide sequence AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD.
• Predicted Species: Porcine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRTFDC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against PRTFDC1 and was validated on Western blot.
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRTFDC1 Antibody

• EC 2.4.2.8
• FLJ11888
• HHGPEC 2.4.2
• phosphoribosyl transferase domain containing 1
• phosphoribosyltransferase domain-containing protein 1

Background

PRTFDC1 belongs to the purine/pyrimidine phosphoribosyltransferase family. Epigenetic silencing of PRTFDC1 by hypermethylation of the CpG islands leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRTFDC1
• Uniprot:
  • Q9NRG1(Human)