PRRG3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PRRG3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRRG3.
  
  

  Source: E. coli

  Amino Acid Sequence: EVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMY

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PRRG3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31832.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRRG3 Recombinant Protein Antigen

• PRGP3MGC156177
• proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane)
• Proline-rich gamma-carboxyglutamic acid protein 3
• Proline-rich Gla protein 3
• TMG3MGC149510
• transmembrane gamma-carboxyglutamic acid protein 3

Background

The PRRG3 gene encodes a 231 amino acid long, 25 kDA transmembrane gamma-carboxyglutamic acid protein 3 that contains a K-dependent carboxylation.gamma-carboxyglutamic domain because the protein belongs to a family of vitamin K-dependent transmembrane proteins. This family of proteins is characterized by obtaining glutamate-rich extracellular domains. The PRRG3 gene has been linked to myopia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PRRG3