Protein phosphatase 1F Recombinant Protein Antigen

Images

 
There are currently no images for Protein phosphatase 1F Protein (NBP1-88206PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Protein phosphatase 1F Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1F.

Source: E. coli

Amino Acid Sequence: VVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88206.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Protein phosphatase 1F Recombinant Protein Antigen

  • Ca(2+)/calmodulin-dependent protein kinase phosphatase
  • CaMKPaseCaM-kinase phosphatase
  • EC 3.1.3.16
  • FEM-2
  • hFEM-2
  • KIAA0015POPX2CAMKP
  • Partner of PIX 2
  • PP2C phosphatase
  • Protein fem-2 homolog
  • protein phosphatase 1F (PP2C domain containing)
  • protein phosphatase 1F
  • protein phosphatase, Mg2+/Mn2+ dependent, 1F

Background

Protein phosphatase 1F is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-16802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF7899
Species: Hu
Applications: IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP1-32751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
MAB41051
Species: Hu, Mu
Applications: WB
NBP1-87249
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3989
Species: Hu, Mu, Rt
Applications: WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-88206PEP
Species: Hu
Applications: AC

Publications for Protein phosphatase 1F Protein (NBP1-88206PEP) (0)

There are no publications for Protein phosphatase 1F Protein (NBP1-88206PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein phosphatase 1F Protein (NBP1-88206PEP) (0)

There are no reviews for Protein phosphatase 1F Protein (NBP1-88206PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Protein phosphatase 1F Protein (NBP1-88206PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protein phosphatase 1F Products

Research Areas for Protein phosphatase 1F Protein (NBP1-88206PEP)

Find related products by research area.

Blogs on Protein phosphatase 1F

There are no specific blogs for Protein phosphatase 1F, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Protein phosphatase 1F Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1F