Recombinant Human Proprotein Convertase 7/PCSK7 Protein

Order Details


    • Catalog Number
      H00009159-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Proprotein Convertase 7/PCSK7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 434-543 of Human PCSK7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVSPVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRGSLE

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCSK7

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Proprotein Convertase 7/PCSK7 Protein

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.61
  • EC 3.4.21.75
  • EC 3.4.21.93
  • hPC8
  • LPC
  • LPCFLJ23503
  • Lymphoma proprotein convertase
  • PC7FLJ45329
  • PC8prohormone convertase PC7
  • PCSK7
  • Prohormone convertase 7
  • Proprotein Convertase 7
  • Proprotein convertase 8
  • proprotein convertase subtilisin/kexin type 7
  • SPC7
  • SPC7proprotein convertase PC7
  • Subtilisin/kexin-like protease PC7

Background

PCSK7 - proprotein convertase subtilisin/kexin type 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB5018
Species: Hu
Applications: WB, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01) (0)

There are no publications for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01) (0)

There are no reviews for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proprotein Convertase 7/PCSK7 Products

Bioinformatics Tool for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01)

Discover related pathways, diseases and genes to Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01)

Discover more about diseases related to Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01).
 

Pathways for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01)

View related products by pathway.

PTMs for Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01)

Learn more about PTMs related to Proprotein Convertase 7/PCSK7 Partial Recombinant Protein (H00009159-Q01).

Blogs on Proprotein Convertase 7/PCSK7

There are no specific blogs for Proprotein Convertase 7/PCSK7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Proprotein Convertase 7/PCSK7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK7
Entrez