Recombinant Human PRMT5 Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, AP

Recombinant Human PRMT5 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 531-637 of Human PRMT5
  
  

  Source: Wheat Germ

  Amino Acid Sequence: DNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: PRMT5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Application Notes: This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
• Theoretical MW: 37.51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRMT5 Protein

• EC 2.1.1.-
• EC 2.1.1.125
• Histone-arginine N-methyltransferase PRMT5
• HMT1 hnRNP methyltransferase-like 5,72 kDa ICln-binding protein
• HRMT1L5
• IBP72
• Jak-binding protein 1
• JBP1
• protein arginine methyltransferase 5
• protein arginine N-methyltransferase 5
• Shk1 kinase-binding protein 1 homolog
• skb1 (S. pombe) homolog
• SKB1 homolog (S. pombe)
• SKB1
• SKB1HsSKB1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PRMT5