Recombinant Human PRMT5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PRMT5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 531-637 of Human PRMT5

Source: Wheat Germ

Amino Acid Sequence: DNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRMT5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRMT5 Protein

  • EC 2.1.1.-
  • EC 2.1.1.125
  • Histone-arginine N-methyltransferase PRMT5
  • HMT1 hnRNP methyltransferase-like 5,72 kDa ICln-binding protein
  • HRMT1L5
  • IBP72
  • Jak-binding protein 1
  • JBP1
  • protein arginine methyltransferase 5
  • protein arginine N-methyltransferase 5
  • Shk1 kinase-binding protein 1 homolog
  • skb1 (S. pombe) homolog
  • SKB1 homolog (S. pombe)
  • SKB1
  • SKB1HsSKB1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-342
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00008294-P01
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRMT5 Partial Recombinant Protein (H00010419-Q01) (0)

There are no publications for PRMT5 Partial Recombinant Protein (H00010419-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRMT5 Partial Recombinant Protein (H00010419-Q01) (0)

There are no reviews for PRMT5 Partial Recombinant Protein (H00010419-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRMT5 Partial Recombinant Protein (H00010419-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRMT5 Products

Bioinformatics Tool for PRMT5 Partial Recombinant Protein (H00010419-Q01)

Discover related pathways, diseases and genes to PRMT5 Partial Recombinant Protein (H00010419-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRMT5 Partial Recombinant Protein (H00010419-Q01)

Discover more about diseases related to PRMT5 Partial Recombinant Protein (H00010419-Q01).
 

Pathways for PRMT5 Partial Recombinant Protein (H00010419-Q01)

View related products by pathway.

PTMs for PRMT5 Partial Recombinant Protein (H00010419-Q01)

Learn more about PTMs related to PRMT5 Partial Recombinant Protein (H00010419-Q01).
 

Research Areas for PRMT5 Partial Recombinant Protein (H00010419-Q01)

Find related products by research area.

Blogs on PRMT5

There are no specific blogs for PRMT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRMT5 Antibody
NB100-56641

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRMT5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRMT5