Recombinant Human PRKCSH Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRKCSH Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 268-377 of Human PRKCSH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRKCSH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRKCSH Protein

  • AGE-R2,80K-H protein
  • G19P1AGE-binding receptor 2
  • glucosidase 2 subunit beta
  • Glucosidase II subunit beta
  • glucosidase II, beta subunit
  • hepatocystin
  • PCLD
  • PKCSH
  • PLD1
  • Protein kinase C substrate 60.1 kDa protein heavy chain
  • protein kinase C substrate 80K-H
  • protein kinase C substrate, 80 Kda protein

Background

PRKCSH - protein kinase C substrate 80K-H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23721
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
H00005589-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PRKCSH Partial Recombinant Protein (H00005589-Q01) (0)

There are no publications for PRKCSH Partial Recombinant Protein (H00005589-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKCSH Partial Recombinant Protein (H00005589-Q01) (0)

There are no reviews for PRKCSH Partial Recombinant Protein (H00005589-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRKCSH Partial Recombinant Protein (H00005589-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRKCSH Products

Bioinformatics Tool for PRKCSH Partial Recombinant Protein (H00005589-Q01)

Discover related pathways, diseases and genes to PRKCSH Partial Recombinant Protein (H00005589-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKCSH Partial Recombinant Protein (H00005589-Q01)

Discover more about diseases related to PRKCSH Partial Recombinant Protein (H00005589-Q01).
 

Pathways for PRKCSH Partial Recombinant Protein (H00005589-Q01)

View related products by pathway.

PTMs for PRKCSH Partial Recombinant Protein (H00005589-Q01)

Learn more about PTMs related to PRKCSH Partial Recombinant Protein (H00005589-Q01).
 

Research Areas for PRKCSH Partial Recombinant Protein (H00005589-Q01)

Find related products by research area.

Blogs on PRKCSH

There are no specific blogs for PRKCSH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRKCSH Antibody
NBP1-32006
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRKCSH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCSH